1.68 Rating by CuteStatLite

It is a domain having .co.za extension. It is estimated worth of R 103.46 and have a daily income of around R 1.73. As no active threats were reported recently, oprahwinfreyleadershipacademy.co.za is SAFE to browse.

Visit Website

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: R 1.73
Estimated Worth: R 103.46

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 100 ON 100
Domain Authority: 1 ON 100
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

South Africa ZA

Location Latitude:


Location Longitude:


Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.

Court Classique Suite Hotel | 4 Star | Pretoria

- classiqueorange.co.za

Nestling in upmarket diplomatic suburb of Arcadia, Pretoria, the Court Classique Suite hotel offers easy access to the major Gauteng business centres ...

  Not Applicable   R 103.46


- ipasafrica.co.za

The International Police Association (IPA) of which South Africa is a member since 1982, has since its Founding 1950 grown to become the world’s oldest and largest police...

  10,305,965   R 103.46

biogreen- renewable energy; biodiesel; biofuels; biomass; carbon...

- biogreendiesel.co.za

A renewable energy company with a sustainable model

  Not Applicable   R 103.46

ASPASA | Aggregate & Sand Producers Association of Southern Africa...

- aspasa.co.za

  Not Applicable   R 103.46

Court Classique Suite Hotel | 4 Star | Pretoria

- courtclassique.co.za

Nestling in upmarket diplomatic suburb of Arcadia, Pretoria, the Court Classique Suite hotel offers easy access to the major Gauteng business centres ...

  5,972,996   R 2,774.40

Backlink History Chart from Majestic SEO

Referring Domains Discovery Chart from Majestic SEO

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Content-Length: 218
Content-Type: text/html
Server: Microsoft-IIS/6.0
MicrosoftOfficeWebServer: 5.0_Pub
X-Powered-By: ASP.NET
Date: Tue, 26 Aug 2014 08:32:33 GMT

Domain Information

Domain Registrar: UniForum Association
Owner's E-Mail: imc-tech@mweb.com

Domain Nameserver Information

Host IP Address Country
ns1.mweb.co.za South Africa South Africa
ns2.mweb.co.za South Africa South Africa

DNS Record Analysis

Host Type TTL Extra
oprahwinfreyleadershipacademy.co.za A 599 IP:
oprahwinfreyleadershipacademy.co.za NS 599 Target: ns1.mweb.co.za
oprahwinfreyleadershipacademy.co.za NS 599 Target: ns2.mweb.co.za
oprahwinfreyleadershipacademy.co.za SOA 599 MNAME: ns1.mweb.co.za
RNAME: dns-admin.mweb.com
Serial: 2010082705
Refresh: 10800
Retry: 7200
Expire: 2592000
oprahwinfreyleadershipacademy.co.za MX 599 Priority: 10
Target: corpmx.worldonline.co.za

Similarly Ranked Websites

Welcome to Facebook - Log In, Sign Up or Learn More

- facebook.com

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with...

  2   R 51,055,103,908.80


- youtube.com

Share your videos with friends, family, and the world

  3   R 34,036,735,939.20


- yahoo.com

A new welcome to Yahoo. The new Yahoo experience makes it easier to discover the news and information that you care about most. It's the web ordered for you.

  4   R 25,527,558,196.80

Welcome to Twitter - Login or Sign up

- twitter.com

Connect with your friends — and other fascinating people. Get in-the-moment updates on the things that interest you. And watch events unfold, in real time, from every angle.

  7   R 14,587,177,896.00

Amazon.com: Online Shopping for Electronics, Apparel, Computers,...

- amazon.com

Online shopping from the earth's biggest selection of books, magazines, music, DVDs, videos, electronics, computers, software, apparel & accessories, shoes, jewelry, tools &...

  7   R 18,408,924,993.60

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

simple CO.ZA whois server
The CO.ZA simple whois server
Copyright UniForum SA
Use of this facility subject to theterms of
site usage
Your query has generated the following

Search on oprahwinfreyleadershipacademy
Match: One


Date |Type| Cost |Invoices are E-Mail to....|Paid Date
|ICnt| TrkNo |Billing Info

Flashing RED indicates that
payment has not been received - please
confirm with the UniForum
SA accounting department, accounts@co.za, should this
not be
according to your records. You have been sent 0

0a. lastupdate :
0b. emailsource
0c. emailposted :
0d. emailsubject :
0g. historycount
0h. invoiceno :
0i. contracttype :
0j. rcsversion
1a. domain : oprahwinfreyleadershipacademy.co.za
1b. action
1c. Registrar : Multichoice Subscriber Management
registrantpostaladdress: PO BOX 1485,HENLEY ON KLIP,MEYERTON,FREE
STATE,1962,-, , , --
2c. registrantstreetaddress:
2d. amount
2e. paymenttype :
2f. billingaccount :
2g. billingemail
2i. invoiceaddress :
2j. registrantphone :
2k. registrantfax : +27.163669004
registrantemail : imc-tech@mweb.com
2n. vat :
3b. cname
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate :
2006/11/08 13:40:41
4a. admin :
4b. admintitle :
admincompany :
4d. adminpostaladdr :
4e. adminphone :
adminfax :
4g. adminemail :
4h. adminnic :
5a. tec
5b. tectitle :
5c. teccompany :
5d. tecpostaladdr
5e. tecphone :
5f. tecfax :
5g. tecemail :
tecnic :
6a. primnsfqdn : ns1.mweb.co.za
6b. primnsip
6c. primnsipv6 :
6e. secns1fqdn : ns2.mweb.co.za
secns1ip :
6g. secns1ipv6 :
6i. secns2fqdn :
6j. secns2ip
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
netblock2start :
8d. netblock2end :
8e. netblock3start
8f. netblock3end :
9a. description1 :
9b. description2
9c. description3 :
9d. description4 :
9e. description5
9f. description6 :

Next Query - Domain
Please refer to the CO.ZA contact details should
you have any problems