It is a domain having .co.za extension. It is estimated worth of R 103.46 and have a daily income of around R 1.73. As no active threats were reported recently, westerncapeemergencyservices.co.za is SAFE to browse.
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Income Per Day: | R 1.73 |
Estimated Worth: | R 103.46 |
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Very Poor |
WOT Privacy: | Very Poor |
WOT Child Safety: | Very Poor |
Google Pagerank: | Not Applicable |
Alexa Rank: | Not Applicable |
PageSpeed Score: | 99 ON 100 |
Domain Authority: | 1 ON 100 |
DMOZ Listing: | No |
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Google+: | Not Applicable |
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Balgair Media is a publishing and creative & editorial photography company, with a sixteen year pedigree in the automotive publishing field
G2Design is a Stellenbosch based graphic design and visual communication agency specialising in strategic brand, corporate identity and website development, corporate brochure,...
Medindi Manor offers luxury Guest House accommodation in Rosebank, Cape Town, to corporate travelers and holiday makers alike who are seeking the design and sophistication.
Camps Bay Accommodation; this self-catering guest house has luxury room accommodation available on the slopes of the twelve apostles at Atlantic Gold. For self-catering luxury...
Host | Type | TTL | Extra |
---|---|---|---|
westerncapeemergencyservices.co.za | A | 7182 |
IP: 196.40.97.164 |
westerncapeemergencyservices.co.za | NS | 7199 |
Target: ns1.host-h.net |
westerncapeemergencyservices.co.za | NS | 7199 |
Target: ns1.dns-h.com |
westerncapeemergencyservices.co.za | NS | 7199 |
Target: ns2.host-h.net |
westerncapeemergencyservices.co.za | SOA | 7199 |
MNAME: ns1.host-h.net RNAME: postmaster.your-server.co.za Serial: 2014091001 Refresh: 86400 Retry: 1800 Expire: 3600000 |
westerncapeemergencyservices.co.za | MX | 7199 |
Priority: 10 Target: mail.westerncapeemergencyservices.co.za |
Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with...
A new welcome to Yahoo. The new Yahoo experience makes it easier to discover the news and information that you care about most. It's the web ordered for you.
Connect with your friends — and other fascinating people. Get in-the-moment updates on the things that interest you. And watch events unfold, in real time, from every angle.
Online shopping from the earth's biggest selection of books, magazines, music, DVDs, videos, electronics, computers, software, apparel & accessories, shoes, jewelry, tools &...