1.68 Rating by CuteStatLite

It is a domain having .co.za extension. It is estimated worth of R 103.46 and have a daily income of around R 1.73. As no active threats were reported recently, westerncapeemergencyservices.co.za is SAFE to browse.

Visit Website

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: R 1.73
Estimated Worth: R 103.46

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
PageSpeed Score: 99 ON 100
Domain Authority: 1 ON 100
DMOZ Listing: No

Web Server Information

Hosted IP Address:

196.40.97.164

Hosted Country:

South Africa ZA

Location Latitude:

-26.2023

Location Longitude:

28.0436

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Page Resources Breakdown

Homepage Links Analysis

This will soon be the new home of the domain www.westerncapeemergencyservices.co.za

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 196.40.97.164)

Balgair Media

- balgair.co.za

Balgair Media is a publishing and creative & editorial photography company, with a sixteen year pedigree in the automotive publishing field

  Not Applicable   R 103.46

G2Design | Graphic Design | Web Design and Development

- fantasties.co.za

G2Design is a Stellenbosch based graphic design and visual communication agency specialising in strategic brand, corporate identity and website development, corporate brochure,...

  Not Applicable   R 103.46

Treated Timber Products

- treatedtimberproducts.co.za

  Not Applicable   R 103.46

Boutique Hotel | Rondebosch | Guest House Cape Town

- medindi.co.za

Medindi Manor offers luxury Guest House accommodation in Rosebank, Cape Town, to corporate travelers and holiday makers alike who are seeking the design and sophistication.

  Not Applicable   R 103.46

Luxury Camps Bay Accommodation | Camps Bay Self-Catering Guest House

- atlanticgold.co.za

Camps Bay Accommodation; this self-catering guest house has luxury room accommodation available on the slopes of the twelve apostles at Atlantic Gold. For self-catering luxury...

  4,897,372   R 2,774.40

Backlink History Chart from Majestic SEO

Referring Domains Discovery Chart from Majestic SEO

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 16 Feb 2015 14:41:22 GMT
Server: Apache
Last-Modified: Fri, 04 Feb 2011 11:35:07 GMT
ETag: "2ea26e-643-49b734621b0c0"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 829
Content-Type: text/html

Domain Information

Domain Registrar: UniForum Association
Owner's E-Mail: fredmunnik@telkomsa.net

DNS Record Analysis

Host Type TTL Extra
westerncapeemergencyservices.co.za A 7182 IP: 196.40.97.164
westerncapeemergencyservices.co.za NS 7199 Target: ns1.host-h.net
westerncapeemergencyservices.co.za NS 7199 Target: ns1.dns-h.com
westerncapeemergencyservices.co.za NS 7199 Target: ns2.host-h.net
westerncapeemergencyservices.co.za SOA 7199 MNAME: ns1.host-h.net
RNAME: postmaster.your-server.co.za
Serial: 2014091001
Refresh: 86400
Retry: 1800
Expire: 3600000
westerncapeemergencyservices.co.za MX 7199 Priority: 10
Target: mail.westerncapeemergencyservices.co.za

Similarly Ranked Websites

Welcome to Facebook - Log In, Sign Up or Learn More

- facebook.com

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with...

  2   R 51,055,103,908.80

YouTube

- youtube.com

Share your videos with friends, family, and the world

  3   R 34,036,735,939.20

Yahoo

- yahoo.com

A new welcome to Yahoo. The new Yahoo experience makes it easier to discover the news and information that you care about most. It's the web ordered for you.

  4   R 25,527,558,196.80

Welcome to Twitter - Login or Sign up

- twitter.com

Connect with your friends — and other fascinating people. Get in-the-moment updates on the things that interest you. And watch events unfold, in real time, from every angle.

  7   R 14,587,177,896.00

Amazon.com: Online Shopping for Electronics, Apparel, Computers,...

- amazon.com

Online shopping from the earth's biggest selection of books, magazines, music, DVDs, videos, electronics, computers, software, apparel & accessories, shoes, jewelry, tools &...

  7   R 18,408,924,993.60

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

simple CO.ZA whois server
The CO.ZA simple whois server
©
Copyright UniForum SA
Use of this facility subject to theterms of
site usage
Your query has generated the following
reply:-

Search on westerncapeemergencyservices
(.co.za)
Match: One

Domain:
westerncapeemergencyservices.co.za

Accounting
info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date
|ICnt| TrkNo |Billing Info

Flashing RED indicates that
payment has not been received - please
confirm with the UniForum
SA accounting department, accounts@co.za, should this
not be
according to your records. You have been sent 0
invoices/statements.

0a. lastupdate :
0b. emailsource
:
0c. emailposted :
0d. emailsubject :
0g. historycount
:
0h. invoiceno :
0i. contracttype :
0j. rcsversion
:
1a. domain : westerncapeemergencyservices.co.za
1b. action
:
1c. Registrar : Hetzner (Pty) Ltd
2a. registrant : Western
Cape Emergency Services
2b. registrantpostaladdress: PO Box 168,
Soneike 7583, South Africa,KUILSRIVIER, , 7583, ZA
2c.
registrantstreetaddress:
2d. amount :
2e. paymenttype
:
2f. billingaccount :
2g. billingemail :
2i.
invoiceaddress :
2j. registrantphone : +27.219030732
2k.
registrantfax :
2l. registrantemail :
fredmunnik@telkomsa.net
2n. vat :
3b. cname :
3c.
cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 2011/02/04
13:35:48
4a. admin :
4b. admintitle :
4c. admincompany
:
4d. adminpostaladdr :
4e. adminphone :
4f. adminfax
:
4g. adminemail :
4h. adminnic :
5a. tec :
5b.
tectitle :
5c. teccompany :
5d. tecpostaladdr :
5e.
tecphone :
5f. tecfax :
5g. tecemail :
5h. tecnic
:
6a. primnsfqdn : ns1.host-h.net
6b. primnsip :
6c.
primnsipv6 :
6e. secns1fqdn : ns2.host-h.net
6f. secns1ip
:
6g. secns1ipv6 :
6i. secns2fqdn : ns1.dns-h.com
6j.
secns2ip :
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip
:
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s.
secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c.
netblock2start :
8d. netblock2end :
8e. netblock3start
:
8f. netblock3end :
9a. description1 :
9b. description2
:
9c. description3 :
9d. description4 :
9e. description5
:
9f. description6 :

Next Query - Domain
name
.co.za
Please refer to the CO.ZA contact details should
you have any problems